Loading...
Statistics
Advertisement

63355.xyz
www.63355.xyz/

63355.xyz

Advertisement
Conversion Technology Metas Server
63355.xyz is hosted in United States / San Jose . 63355.xyz doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Javascript, Php, Number of used javascripts: 2. First javascripts: Caf.js, Parking_caf_547_1608221.js, Number of used analytics tools: 0. Its server type is: Tengine/1.4.2.

Technologies in use by 63355.xyz

Technology

Number of occurences: 3
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 2
  • caf.js
  • parking_caf_547_1608221.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Tengine/1.4.2

Powered by

  • PHP/5.3.10

CDN

Number of occurences: 1
  • CloudFront

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - 63355.xyz

Missing HTTPS protocol.

    Meta - 63355.xyz

    Number of occurences: 1
    • Name:
      Content: text/html; charset=utf-8

    Server / Hosting

    • IP: 23.27.192.115
    • Latitude: 37.34
    • Longitude: -121.89
    • Country: United States
    • City: San Jose

    HTTP Header Response

    HTTP/1.1 200 OK Server: Tengine/1.4.2 Date: Wed, 28 Sep 2016 17:55:01 GMT Content-Type: text/html;charset=utf-8 Vary: Accept-Encoding X-Powered-By: PHP/5.3.10 Set-Cookie: PHPSESSID=m90d9vji5fvi1u1jelaq6pgas5; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache X-Cache: MISS from s_ub15 Transfer-Encoding: chunked Via: 1.1 s_ub15 (squid/3.5.20) Connection: keep-alive

    DNS

    host: 63355.xyz
    1. class: IN
    2. ttl: 86400
    3. type: A
    4. ip: 23.27.192.115

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.3355.xyz, www.6r3355.xyz, www.r3355.xyz, www.6t3355.xyz, www.t3355.xyz, www.6z3355.xyz, www.z3355.xyz, www.6y3355.xyz, www.y3355.xyz, www.643355.xyz, www.43355.xyz, www.6355.xyz, www.63q355.xyz, www.6q355.xyz, www.63w355.xyz, www.6w355.xyz, www.63e355.xyz, www.6e355.xyz, www.63355.xyz, www.6355.xyz, www.631355.xyz, www.61355.xyz, www.6355.xyz, www.633q55.xyz, www.63q55.xyz, www.633w55.xyz, www.63w55.xyz, www.633e55.xyz, www.63e55.xyz, www.63355.xyz, www.6355.xyz, www.633155.xyz, www.63155.xyz, www.6335.xyz, www.6335e5.xyz, www.633e5.xyz, www.6335r5.xyz, www.633r5.xyz, www.633525.xyz, www.63325.xyz, www.6335t5.xyz, www.633t5.xyz, www.633535.xyz, www.63335.xyz, www.6335.xyz, www.63355e.xyz, www.6335e.xyz, www.63355r.xyz, www.6335r.xyz, www.633552.xyz, www.63352.xyz, www.63355t.xyz, www.6335t.xyz, www.633553.xyz, www.63353.xyz,

    Other websites we recently analyzed

    1. virgingalacticspaceflightsystems.com
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    2. cheaplouboutinsssstores.com
      Switzerland - 141.8.225.181
      Server software: nginx/1.9.2
      Technology: Html
    3. ITAIM KEIKO - Longevidade no Esporte Tênis de Mesa
      Academia de Tênis de Mesa Especializada
      Houston (United States) - 192.185.217.48
      Server software: Apache
      Technology: CSS, Google Font API, Html, Html5, Javascript
      Number of Javascript: 12
      Number of meta tags: 5
    4. petalumahomesonline.com
      Scottsdale (United States) - 184.168.221.61
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    5. Intro
      Berlin (Germany) - 81.169.145.151
      Server software: Apache/2.2.31 (Unix)
      Technology: Html
      Number of meta tags: 1
    6. www.superbugs.tv
      Ashburn (United States) - 52.0.217.44
      Server software:
      Technology: CSS, Html, Javascript
      Number of Javascript: 2
      Number of meta tags: 2
    7. magazines-america.com
      Scottsdale (United States) - 50.63.202.93
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    8. Kulturno i sportsko društvo SANDŽAK u Sloveniji
      Slovenia - 91.185.211.46
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery Cookie, Php, Swf Object
      Number of Javascript: 10
      Number of meta tags: 4
    9. jasonpcollier.com
      Scottsdale (United States) - 50.63.202.59
      Server software:
      Technology: Html, Html5, Iframe
    10. www.4WARD4x4.com
      Germany - 46.252.18.149
      Server software: Apache/2.4.20
      Technology: Html

    Check Other Websites